Lineage for d2uugd_ (2uug D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2937388Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 2937389Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 2937390Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)
  7. 2937395Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)
  8. 2937409Domain d2uugd_: 2uug D: [38139]
    Other proteins in same PDB: d2uuga_, d2uugb_
    protein/DNA complex; mutant

Details for d2uugd_

PDB Entry: 2uug (more details), 2.6 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
PDB Compounds: (D:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2uugd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uugd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOPe Domain Coordinates for d2uugd_:

Click to download the PDB-style file with coordinates for d2uugd_.
(The format of our PDB-style files is described here.)

Timeline for d2uugd_: