![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
![]() | Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [102683] (6 PDB entries) |
![]() | Domain d6p5xb3: 6p5x B:216-457 [381384] Other proteins in same PDB: d6p5xa1, d6p5xa2, d6p5xb1, d6p5xb2 automated match to d1pjta2 complexed with cl, sah, shn |
PDB Entry: 6p5x (more details), 1.97 Å
SCOPe Domain Sequences for d6p5xb3:
Sequence, based on SEQRES records: (download)
>d6p5xb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs nh
>d6p5xb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkravpq eeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsay sgiplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadm pvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh
Timeline for d6p5xb3: