Lineage for d6p5xb2 (6p5x B:114-215)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625759Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 2625760Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) (S)
  5. 2625761Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)
  6. 2625767Protein Siroheme synthase CysG, domains 2 and 3 [103403] (2 species)
  7. 2625771Species Salmonella typhimurium [TaxId:90371] [103404] (5 PDB entries)
  8. 2625773Domain d6p5xb2: 6p5x B:114-215 [381383]
    Other proteins in same PDB: d6p5xa1, d6p5xa3, d6p5xb1, d6p5xb3
    automated match to d1pjta3
    complexed with cl, sah, shn

Details for d6p5xb2

PDB Entry: 6p5x (more details), 1.97 Å

PDB Description: sirohydrochlorin-bound s. typhimurium siroheme synthase
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6p5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p5xb2 e.37.1.1 (B:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

SCOPe Domain Coordinates for d6p5xb2:

Click to download the PDB-style file with coordinates for d6p5xb2.
(The format of our PDB-style files is described here.)

Timeline for d6p5xb2: