![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
![]() | Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
![]() | Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
![]() | Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries) |
![]() | Domain d2uugc_: 2uug C: [38138] Other proteins in same PDB: d2uuga_, d2uugb_ protein/DNA complex; mutant |
PDB Entry: 2uug (more details), 2.6 Å
SCOPe Domain Sequences for d2uugc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uugc_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda peykpwalviqdsngenkikml
Timeline for d2uugc_: