SCOP 1.75: Domain d2uugc_: 2uug C:

Lineage for d2uugc_ (2uug C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries)

8. Domain d2uugc_: 2uug C: [38138]
   Other proteins in same PDB: d2uuga_, d2uugb_

Details for d2uugc_

PDB Entry: 2uug, 2.6 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi

PDB Compounds: (C:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d2uugc_:

Sequence; same for both SEQRES and ATOM records:

>d2uugc_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

Timeline for d2uugc_:

• d2uugc_ first appeared (with stable ids) in SCOP 1.55
  
• d2uugc_ appears in SCOP 1.73
  
• d2uugc_ appears in SCOPe 2.01
  
• d2uugc_ appears in the current release, SCOPe 2.08