Lineage for d2uugc_ (2uug C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 31129Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
  5. 31130Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 31131Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 31134Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries)
  8. 31148Domain d2uugc_: 2uug C: [38138]
    Other proteins in same PDB: d2uuga_, d2uugb_

Details for d2uugc_

PDB Entry: 2uug (more details), 2.6 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi

SCOP Domain Sequences for d2uugc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uugc_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOP Domain Coordinates for d2uugc_:

Click to download the PDB-style file with coordinates for d2uugc_.
(The format of our PDB-style files is described here.)

Timeline for d2uugc_: