Lineage for d1uugd_ (1uug D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 719236Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 719237Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 719238Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 719241Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries)
  8. 719256Domain d1uugd_: 1uug D: [38137]
    Other proteins in same PDB: d1uuga_, d1uugc_

Details for d1uugd_

PDB Entry: 1uug (more details), 2.4 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi
PDB Compounds: (D:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d1uugd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uugd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOP Domain Coordinates for d1uugd_:

Click to download the PDB-style file with coordinates for d1uugd_.
(The format of our PDB-style files is described here.)

Timeline for d1uugd_: