Lineage for d1uugb_ (1uug B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190250Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
  5. 190251Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 190252Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 190255Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries)
  8. 190267Domain d1uugb_: 1uug B: [38136]
    Other proteins in same PDB: d1uuga_, d1uugc_

Details for d1uugb_

PDB Entry: 1uug (more details), 2.4 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi

SCOP Domain Sequences for d1uugb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uugb_ d.17.5.1 (B:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOP Domain Coordinates for d1uugb_:

Click to download the PDB-style file with coordinates for d1uugb_.
(The format of our PDB-style files is described here.)

Timeline for d1uugb_: