Lineage for d6pr2b3 (6pr2 B:216-455)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2911792Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2912005Protein automated matches [190790] (4 species)
    not a true protein
  7. 2912010Species Salmonella typhimurium [TaxId:90371] [381349] (8 PDB entries)
  8. 2912018Domain d6pr2b3: 6pr2 B:216-455 [381358]
    Other proteins in same PDB: d6pr2a1, d6pr2a2, d6pr2b1, d6pr2b2
    automated match to d1pjqa2
    complexed with cl, mes, sah

Details for d6pr2b3

PDB Entry: 6pr2 (more details), 2.16 Å

PDB Description: r261a/s128a s. typhimurium siroheme synthase
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6pr2b3:

Sequence, based on SEQRES records: (download)

>d6pr2b3 c.90.1.1 (B:216-455) automated matches {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvradadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs

Sequence, based on observed residues (ATOM records): (download)

>d6pr2b3 c.90.1.1 (B:216-455) automated matches {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvradadrvfvgvpqeei
nqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgi
plthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadmpva
lvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs

SCOPe Domain Coordinates for d6pr2b3:

Click to download the PDB-style file with coordinates for d6pr2b3.
(The format of our PDB-style files is described here.)

Timeline for d6pr2b3: