Lineage for d6pr1b1 (6pr1 B:1-113)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848399Species Salmonella typhimurium [TaxId:90371] [381343] (9 PDB entries)
  8. 2848401Domain d6pr1b1: 6pr1 B:1-113 [381344]
    Other proteins in same PDB: d6pr1a2, d6pr1a3, d6pr1b2, d6pr1b3
    automated match to d1pjqa1
    complexed with cl, sah

Details for d6pr1b1

PDB Entry: 6pr1 (more details), 1.82 Å

PDB Description: r260a/s128a s. typhimurium siroheme synthase
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6pr1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pr1b1 c.2.1.0 (B:1-113) automated matches {Salmonella typhimurium [TaxId: 90371]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

SCOPe Domain Coordinates for d6pr1b1:

Click to download the PDB-style file with coordinates for d6pr1b1.
(The format of our PDB-style files is described here.)

Timeline for d6pr1b1: