SCOPe 2.04: Domain d2ugia_: 2ugi A:

Lineage for d2ugia_ (2ugi A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries)

8. Domain d2ugia_: 2ugi A: [38134]
   protein/DNA complex; complexed with imd

Details for d2ugia_

PDB Entry: 2ugi, 2.2 Å

PDB Description: protein mimicry of dna from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-dna glycosylase

PDB Compounds: (A:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2ugia_:

Sequence; same for both SEQRES and ATOM records:

>d2ugia_ d.17.5.1 (A:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

Timeline for d2ugia_:

• d2ugia_ first appeared (with stable ids) in SCOP 1.55
  
• d2ugia_ appears in SCOPe 2.03
  
• d2ugia_ appears in SCOPe 2.05
  
• d2ugia_ appears in the current release, SCOPe 2.08