Lineage for d2ugia_ (2ugi A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) 
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) 
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries) 
Domain d2ugia_: 2ugi A: [38134]
Details for d2ugia_
PDB Entry: 2ugi (more details), 2.2 Å
PDB Description: protein mimicry of dna from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-dna glycosylase
SCOP Domain Sequences for d2ugia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ugia_ d.17.5.1 (A:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml
SCOP Domain Coordinates for d2ugia_:
Click to download the PDB-style file with coordinates for d2ugia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ugia_:
- d2ugia_ appears in SCOP 1.57
- d2ugia_ appears in the current release, SCOPe 2.08
View in 3D
