Lineage for d6l8tl1 (6l8t L:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742300Domain d6l8tl1: 6l8t L:1-112 [381338]
    Other proteins in same PDB: d6l8ta_, d6l8tb2, d6l8tc_, d6l8td2, d6l8th_, d6l8tl2
    automated match to d1t66c1

Details for d6l8tl1

PDB Entry: 6l8t (more details), 1.77 Å

PDB Description: crystal structure of the fab fragment of a humanized hbv therapeutic antibody
PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d6l8tl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l8tl1 b.1.1.1 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqsplslpvtlgepasiscrssqslvhsygdtylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrvetedlgvyycsqnthvpytfgggtkleik

SCOPe Domain Coordinates for d6l8tl1:

Click to download the PDB-style file with coordinates for d6l8tl1.
(The format of our PDB-style files is described here.)

Timeline for d6l8tl1: