SCOPe 2.07: Domain d6o36b_: 6o36 B:

Lineage for d6o36b_ (6o36 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d6o36b_: 6o36 B: [381337]
   automated match to d4obea_
   complexed with gnp, mg, po4; mutant

Details for d6o36b_

PDB Entry: 6o36, 2 Å

PDB Description: crystal structure of human kras p34r mutant in complex with gnp

PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d6o36b_:

Sequence; same for both SEQRES and ATOM records:

>d6o36b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydrtiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d6o36b_:

• d6o36b_ is new in SCOPe 2.07-stable
  
• d6o36b_ appears in the current release, SCOPe 2.08