SCOP 1.73: Domain d1ughi_: 1ugh I:

Lineage for d1ughi_ (1ugh I:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries)

8. Domain d1ughi_: 1ugh I: [38133]
   Other proteins in same PDB: d1ughe_
   mutant

Details for d1ughi_

PDB Entry: 1ugh, 1.9 Å

PDB Description: crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna

PDB Compounds: (I:) protein (uracil-DNA glycosylase inhibitor)

SCOP Domain Sequences for d1ughi_:

Sequence; same for both SEQRES and ATOM records:

>d1ughi_ d.17.5.1 (I:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

Timeline for d1ughi_:

• d1ughi_ first appeared (with stable ids) in SCOP 1.55
  
• d1ughi_ appears in SCOP 1.71
  
• d1ughi_ appears in SCOP 1.75
  
• d1ughi_ appears in the current release, SCOPe 2.08