Lineage for d1ugih_ (1ugi H:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 719236Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 719237Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 719238Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 719241Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries)
  8. 719249Domain d1ugih_: 1ugi H: [38132]
    complexed with imd, so4

Details for d1ugih_

PDB Entry: 1ugi (more details), 1.55 Å

PDB Description: uracil-dna glycosylase inhibitor protein
PDB Compounds: (H:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d1ugih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugih_ d.17.5.1 (H:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

SCOP Domain Coordinates for d1ugih_:

Click to download the PDB-style file with coordinates for d1ugih_.
(The format of our PDB-style files is described here.)

Timeline for d1ugih_: