| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
| Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
| Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
| Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries) |
| Domain d1ugig_: 1ugi G: [38131] |
PDB Entry: 1ugi (more details), 1.55 Å
SCOP Domain Sequences for d1ugig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugig_ d.17.5.1 (G:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml
Timeline for d1ugig_: