Lineage for d1ugid_ (1ugi D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1641602Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 1641603Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 1641604Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 1641607Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries)
  8. 1641611Domain d1ugid_: 1ugi D: [38128]
    complexed with imd, so4

Details for d1ugid_

PDB Entry: 1ugi (more details), 1.55 Å

PDB Description: uracil-dna glycosylase inhibitor protein
PDB Compounds: (D:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d1ugid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugid_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOPe Domain Coordinates for d1ugid_:

Click to download the PDB-style file with coordinates for d1ugid_.
(The format of our PDB-style files is described here.)

Timeline for d1ugid_: