Lineage for d1ugid_ (1ugi D:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) 
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) 
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries) 
Domain d1ugid_: 1ugi D: [38128]
Details for d1ugid_
PDB Entry: 1ugi (more details), 1.55 Å
PDB Description: uracil-dna glycosylase inhibitor protein
SCOP Domain Sequences for d1ugid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugid_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml
SCOP Domain Coordinates for d1ugid_:
Click to download the PDB-style file with coordinates for d1ugid_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ugid_:
- d1ugid_ appears in SCOP 1.57
- d1ugid_ appears in the current release, SCOPe 2.08
View in 3D
