Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) |
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
Species Bacteriophage pbs2 [TaxId:10684] [54445] (6 PDB entries) |
Domain d1ugic_: 1ugi C: [38127] |
PDB Entry: 1ugi (more details), 1.55 Å
SCOP Domain Sequences for d1ugic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugic_ d.17.5.1 (C:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2} tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd apeykpwalviqdsngenkikml
Timeline for d1ugic_: