Lineage for d6vfne_ (6vfn E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969016Species Bacillus thuringiensis [TaxId:1428] [381227] (1 PDB entry)
  8. 2969021Domain d6vfne_: 6vfn E: [381267]
    automated match to d5cnpc_
    complexed with spm

Details for d6vfne_

PDB Entry: 6vfn (more details), 2.5 Å

PDB Description: crystal structure of speg allosteric polyamine acetyltransferase from bacillus thuringiensis in complex with spermine
PDB Compounds: (E:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d6vfne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vfne_ d.108.1.0 (E:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
elklrpleredlkfvhelnnnahimsywfeepyeafvelqdlydkhihdqserrfivekd
nemvglvelveidyihrrtefqiiidpnyqgygyavdatrlamdyafsvlnmhkiylvvd
kenekavhvykkvgfmvegelideffvdgnyhnairmcmfqkqyfen

SCOPe Domain Coordinates for d6vfne_:

Click to download the PDB-style file with coordinates for d6vfne_.
(The format of our PDB-style files is described here.)

Timeline for d6vfne_: