SCOPe 2.08: Domain d6u39q_: 6u39 Q:

Lineage for d6u39q_ (6u39 Q:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (13 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
   Uniprot P02593

8. Domain d6u39q_: 6u39 Q: [381250]
   automated match to d1dmoa_
   complexed with ca
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d6u39q_

PDB Entry: 6u39, 2.4 Å

PDB Description: 2.4 angstrom crystal structure of the d129g ca-cam:cav1.2 iq domain complex

PDB Compounds: (Q:) Calmodulin-1

SCOPe Domain Sequences for d6u39q_:

Sequence, based on SEQRES records:

>d6u39q_ a.39.1.5 (Q:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevde
mireagidgdgqvnyeefvqmmta

Sequence, based on observed residues (ATOM records):

>d6u39q_ a.39.1.5 (Q:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmareeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireagi
dgdgqvnyeefvqmmta

Timeline for d6u39q_:

• d6u39q_ first appeared in SCOPe 2.07