Lineage for d1ugia_ (1ugi A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 600151Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 600152Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 600153Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 600156Species Bacteriophage pbs2 [TaxId:10684] [54445] (8 PDB entries)
  8. 600157Domain d1ugia_: 1ugi A: [38125]

Details for d1ugia_

PDB Entry: 1ugi (more details), 1.55 Å

PDB Description: uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1ugia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugia_ d.17.5.1 (A:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

SCOP Domain Coordinates for d1ugia_:

Click to download the PDB-style file with coordinates for d1ugia_.
(The format of our PDB-style files is described here.)

Timeline for d1ugia_: