SCOPe 2.05: Domain d1udii_: 1udi I:

Lineage for d1udii_ (1udi I:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs1 [TaxId:10683] [54444] (1 PDB entry)

8. Domain d1udii_: 1udi I: [38124]
   Other proteins in same PDB: d1udie_
   protein/DNA complex

Details for d1udii_

PDB Entry: 1udi, 2.7 Å

PDB Description: nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex

PDB Compounds: (I:) uracil-DNA glycosylase inhibitor protein

SCOPe Domain Sequences for d1udii_:

Sequence; same for both SEQRES and ATOM records:

>d1udii_ d.17.5.1 (I:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs1 [TaxId: 10683]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

Timeline for d1udii_:

• d1udii_ first appeared (with stable ids) in SCOP 1.55
  
• d1udii_ appears in SCOPe 2.04
  
• d1udii_ appears in SCOPe 2.06
  
• d1udii_ appears in the current release, SCOPe 2.08