Lineage for d1udii_ (1udi I:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 254865Fold d.17: Cystatin-like [54402] (5 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 255161Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 255162Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 255163Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 255164Species Bacteriophage pbs1 [TaxId:10683] [54444] (1 PDB entry)
  8. 255165Domain d1udii_: 1udi I: [38124]
    Other proteins in same PDB: d1udie_

Details for d1udii_

PDB Entry: 1udi (more details), 2.7 Å

PDB Description: nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex

SCOP Domain Sequences for d1udii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udii_ d.17.5.1 (I:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs1}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

SCOP Domain Coordinates for d1udii_:

Click to download the PDB-style file with coordinates for d1udii_.
(The format of our PDB-style files is described here.)

Timeline for d1udii_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1udie_