![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.17: Cystatin-like [54402] (5 superfamilies) |
![]() | Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() |
![]() | Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
![]() | Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
![]() | Species Bacteriophage pbs1 [TaxId:10683] [54444] (1 PDB entry) |
![]() | Domain d1udii_: 1udi I: [38124] Other proteins in same PDB: d1udie_ |
PDB Entry: 1udi (more details), 2.7 Å
SCOP Domain Sequences for d1udii_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udii_ d.17.5.1 (I:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs1} tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd apeykpwalviqdsngenkikml
Timeline for d1udii_: