Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species) |
Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries) |
Domain d1ndod_: 1ndo D: [38122] Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2 complexed with fe, fes |
PDB Entry: 1ndo (more details), 2.25 Å
SCOPe Domain Sequences for d1ndod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndod_ d.17.4.4 (D:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]} miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp erilqthnlmvfl
Timeline for d1ndod_: