Lineage for d1ndob_ (1ndo B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543705Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 2543706Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)
  8. 2543716Domain d1ndob_: 1ndo B: [38121]
    Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2
    complexed with fe, fes

Details for d1ndob_

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase
PDB Compounds: (B:) napthalene 1,2-dioxygenase

SCOPe Domain Sequences for d1ndob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndob_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOPe Domain Coordinates for d1ndob_:

Click to download the PDB-style file with coordinates for d1ndob_.
(The format of our PDB-style files is described here.)

Timeline for d1ndob_: