SCOPe 2.08: Domain d6v7lc2: 6v7l C:246-424

Lineage for d6v7lc2 (6v7l C:246-424)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries)

8. Domain d6v7lc2: 6v7l C:246-424 [381200]
   automated match to d2cava2
   complexed with bez

Details for d6v7lc2

PDB Entry: 6v7l, 2.8 Å

PDB Description: the structure of the p212121 crystal form of canavalin at 173 k

PDB Compounds: (C:) canavalin

SCOPe Domain Sequences for d6v7lc2:

Sequence, based on SEQRES records:

>d6v7lc2 b.82.1.2 (C:246-424) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaasdlnmv
gigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqpr

Sequence, based on observed residues (ATOM records):

>d6v7lc2 b.82.1.2 (C:246-424) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvglmqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenne
rnflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqpr

Timeline for d6v7lc2:

• d6v7lc2 first appeared in SCOPe 2.07