![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.17: Cystatin-like [54402] (5 superfamilies) |
![]() | Superfamily d.17.4: NTF2-like [54427] (4 families) ![]() |
![]() | Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein) |
![]() | Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [54440] (2 PDB entries) |
![]() | Domain d1eg9b_: 1eg9 B: [38120] Other proteins in same PDB: d1eg9a1, d1eg9a2 |
PDB Entry: 1eg9 (more details), 1.6 Å
SCOP Domain Sequences for d1eg9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eg9b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida} miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp erilqthnlmvfl
Timeline for d1eg9b_: