Lineage for d6u3db_ (6u3d B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710701Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
    Uniprot P02593
  8. 2710740Domain d6u3db_: 6u3d B: [381196]
    automated match to d2n27a_
    complexed with ca

Details for d6u3db_

PDB Entry: 6u3d (more details), 1.75 Å

PDB Description: 1.75 angstrom crystal structure of the n53i ca-cam:cav1.2 iq domain complex
PDB Compounds: (B:) Calmodulin-1

SCOPe Domain Sequences for d6u3db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u3db_ a.39.1.5 (B:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdmiievdadgng
tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev
demireadidgdgqvnyeefvqmmta

SCOPe Domain Coordinates for d6u3db_:

Click to download the PDB-style file with coordinates for d6u3db_.
(The format of our PDB-style files is described here.)

Timeline for d6u3db_: