Lineage for d6ufyd1 (6ufy D:2-328)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995906Species Bacteroides thetaiotaomicron [TaxId:226186] [381167] (1 PDB entry)
  8. 2995910Domain d6ufyd1: 6ufy D:2-328 [381168]
    Other proteins in same PDB: d6ufya2, d6ufyb2, d6ufyc2, d6ufyd2
    automated match to d5j9ra_

Details for d6ufyd1

PDB Entry: 6ufy (more details), 2.71 Å

PDB Description: b. theta bile salt hydrolase
PDB Compounds: (D:) choloylglycine hydrolase

SCOPe Domain Sequences for d6ufyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ufyd1 d.153.1.0 (D:2-328) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ctravylgpdrmvvtgrtmdwkedimsniyvfprgmqraghnkektvnwtskygsviatg
ydigtcdgmnekglvasllflpesvyslpgdtrpamgisiwtqyvldnfatvreavdemk
ketfridaprmpnggpestlhmaitdetgntavieyldgklsihegkeyqvmtnspryel
qlavndywkevgglqmlpgtnrssdrfvrasfyihaipqtadakiavpsvlsvmrnvsvp
fgintpekphisstrwrsvsdqknkvyyfestltpnlfwldlkkidfspkagvkklsltk
geiyagdavkdlkdsqsftflfetpvm

SCOPe Domain Coordinates for d6ufyd1:

Click to download the PDB-style file with coordinates for d6ufyd1.
(The format of our PDB-style files is described here.)

Timeline for d6ufyd1: