Lineage for d6u39m_ (6u39 M:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2323778Protein Calmodulin [47516] (14 species)
  7. 2323779Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (34 PDB entries)
  8. 2323812Domain d6u39m_: 6u39 M: [381161]
    automated match to d1dmoa_
    complexed with ca

Details for d6u39m_

PDB Entry: 6u39 (more details), 2.4 Å

PDB Description: 2.4 angstrom crystal structure of the d129g ca-cam:cav1.2 iq domain complex
PDB Compounds: (M:) Calmodulin-1

SCOPe Domain Sequences for d6u39m_:

Sequence, based on SEQRES records: (download)

>d6u39m_ a.39.1.5 (M:) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem
ireagidgdgqvnyeefvqmmta

Sequence, based on observed residues (ATOM records): (download)

>d6u39m_ a.39.1.5 (M:) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]}
teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
fpefltmmarkeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireagidg
dgqvnyeefvqmmta

SCOPe Domain Coordinates for d6u39m_:

Click to download the PDB-style file with coordinates for d6u39m_.
(The format of our PDB-style files is described here.)

Timeline for d6u39m_: