Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d6s9ef2: 6s9e F:77-378 [381139] Other proteins in same PDB: d6s9ea1, d6s9ea2, d6s9eb1, d6s9eb2, d6s9ec1, d6s9ec2, d6s9ed1, d6s9ed2, d6s9ee_, d6s9ef1 automated match to d3tiia2 complexed with acp, af3, ca, cl, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 6s9e (more details), 2.25 Å
SCOPe Domain Sequences for d6s9ef2:
Sequence, based on SEQRES records: (download)
>d6s9ef2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d6s9ef2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviypderevflaayngnvwiakssisseaselldfivh viqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsaqdktchltn hciqkenygryeegnemffeefnqylmdalnttlensillqikhiirsclmciepaistk hlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplasif ikl
Timeline for d6s9ef2: