Lineage for d1buqa_ (1buq A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505452Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2505453Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2505454Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)
  8. 2505522Domain d1buqa_: 1buq A: [38111]
    complexed with nth

Details for d1buqa_

PDB Entry: 1buq (more details)

PDB Description: solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
PDB Compounds: (A:) protein (3-ketosteroid isomerase-19-nortestosterone-hemisuccinate)

SCOPe Domain Sequences for d1buqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buqa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaaireffanslk
lplaveltqevravaneaafaftvsfefqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOPe Domain Coordinates for d1buqa_:

Click to download the PDB-style file with coordinates for d1buqa_.
(The format of our PDB-style files is described here.)

Timeline for d1buqa_: