SCOPe 2.08: Domain d6pumd1: 6pum D:1-110

Lineage for d6pumd1 (6pum D:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6pumd1: 6pum D:1-110 [381109]
   Other proteins in same PDB: d6puma1, d6puma3, d6pumb1, d6pumb2, d6pumc1, d6pumc3, d6pumd2, d6pumf1, d6pumf2, d6pumg2
   automated match to d2f54d1
   complexed with gol, na, q84

Details for d6pumd1

PDB Entry: 6pum, 1.96 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-2'd-5-op-ru

PDB Compounds: (D:) TcR alpha chain

SCOPe Domain Sequences for d6pumd1:

Sequence; same for both SEQRES and ATOM records:

>d6pumd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

Timeline for d6pumd1:

• d6pumd1 first appeared in SCOPe 2.07