Lineage for d1iskb_ (1isk B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162085Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2162086Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2162087Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)
  8. 2162154Domain d1iskb_: 1isk B: [38110]

Details for d1iskb_

PDB Entry: 1isk (more details)

PDB Description: 3-oxo-delta5-steroid isomerase, nmr, 20 structures
PDB Compounds: (B:) 3-oxo-delta5-steroid isomerase

SCOPe Domain Sequences for d1iskb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iskb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairefyanslk
lplaveltqevravaneaafaftvsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOPe Domain Coordinates for d1iskb_:

Click to download the PDB-style file with coordinates for d1iskb_.
(The format of our PDB-style files is described here.)

Timeline for d1iskb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iska_