Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) |
Domain d6s9ea1: 6s9e A:1-245 [381099] Other proteins in same PDB: d6s9ea2, d6s9eb2, d6s9ec2, d6s9ed2, d6s9ee_, d6s9ef1, d6s9ef2 automated match to d1tuba1 complexed with acp, af3, ca, cl, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 6s9e (more details), 2.25 Å
SCOPe Domain Sequences for d6s9ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s9ea1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d6s9ea1: