Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries) |
Domain d6rh2d_: 6rh2 D: [381094] Other proteins in same PDB: d6rh2a1, d6rh2a2, d6rh2b1, d6rh2b2 automated match to d3dgec_ complexed with adp, so4 |
PDB Entry: 6rh2 (more details), 2 Å
SCOPe Domain Sequences for d6rh2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rh2d_ c.23.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]} skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivlaimmpvmdg ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
Timeline for d6rh2d_: