SCOPe 2.07: Domain d6rh1b2: 6rh1 B:321-479

Lineage for d6rh1b2 (6rh1 B:321-479)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein automated matches [190839] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [232020] (7 PDB entries)

8. Domain d6rh1b2: 6rh1 B:321-479 [381091]
   Other proteins in same PDB: d6rh1a1, d6rh1b1, d6rh1c_, d6rh1d_
   automated match to d2c2aa2
   complexed with adp, so4

Details for d6rh1b2

PDB Entry: 6rh1, 2 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7

PDB Compounds: (B:) sensor histidine kinase

SCOPe Domain Sequences for d6rh1b2:

Sequence; same for both SEQRES and ATOM records:

>d6rh1b2 d.122.1.3 (B:321-479) automated matches {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkd

Timeline for d6rh1b2:

• d6rh1b2 is new in SCOPe 2.07-stable
  
• d6rh1b2 appears in the current release, SCOPe 2.08