SCOPe 2.08: Domain d6rvmb2: 6rvm B:209-315

Lineage for d6rvmb2 (6rvm B:209-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [327472] (14 PDB entries)

8. Domain d6rvmb2: 6rvm B:209-315 [381087]
   Other proteins in same PDB: d6rvma1, d6rvmb1, d6rvmc1, d6rvmc3, d6rvmd1, d6rvmd3
   automated match to d4m8ia2
   complexed with cl, gol, mg, so4

Details for d6rvmb2

PDB Entry: 6rvm, 2.16 Å

PDB Description: cell division protein ftsz from staphylococcus aureus, apo form

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d6rvmb2:

Sequence, based on SEQRES records:

>d6rvmb2 d.79.2.0 (B:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

Sequence, based on observed residues (ATOM records):

>d6rvmb2 d.79.2.0 (B:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgraveaakkaissplletsivgaqgvlmnitggesl
slfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

Timeline for d6rvmb2:

• d6rvmb2 first appeared in SCOPe 2.07