SCOPe 2.07: Domain d6qznc2: 6qzn C:86-194

Lineage for d6qznc2 (6qzn C:86-194)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries)

8. Domain d6qznc2: 6qzn C:86-194 [381075]
   Other proteins in same PDB: d6qzna1, d6qznc1
   automated match to d3dc5a2
   complexed with mn, so4; mutant

Details for d6qznc2

PDB Entry: 6qzn, 1.64 Å

PDB Description: h30 mnsod-3 mutant iii

PDB Compounds: (C:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d6qznc2:

Sequence; same for both SEQRES and ATOM records:

>d6qznc2 d.44.1.0 (C:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanqdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

Timeline for d6qznc2:

• d6qznc2 is new in SCOPe 2.07-stable
  
• d6qznc2 appears in the current release, SCOPe 2.08