Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
Protein automated matches [190839] (4 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [232020] (7 PDB entries) |
Domain d6rgza2: 6rgz A:321-479 [381069] Other proteins in same PDB: d6rgza1, d6rgzb1, d6rgzc_, d6rgzd_ automated match to d2c2aa2 complexed with adp, cl, mg, so4 |
PDB Entry: 6rgz (more details), 2.35 Å
SCOPe Domain Sequences for d6rgza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rgza2 d.122.1.3 (A:321-479) automated matches {Thermotoga maritima [TaxId: 2336]} qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp gtglglaitkeivelhggriwvesevgkgsrffvwipkd
Timeline for d6rgza2:
View in 3D Domains from other chains: (mouse over for more information) d6rgzb1, d6rgzb2, d6rgzc_, d6rgzd_ |