SCOPe 2.07: Domain d6rh8b1: 6rh8 B:243-320

Lineage for d6rh8b1 (6rh8 B:243-320)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231990] (7 PDB entries)

8. Domain d6rh8b1: 6rh8 B:243-320 [381059]
   Other proteins in same PDB: d6rh8a2, d6rh8b2, d6rh8c_, d6rh8d_
   automated match to d2c2aa1
   complexed with adp, so4; mutant

Details for d6rh8b1

PDB Entry: 6rh8, 1.9 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853 mutant h260a -rr468 mutant d53a ph 5.3

PDB Compounds: (B:) sensor histidine kinase

SCOPe Domain Sequences for d6rh8b1:

Sequence; same for both SEQRES and ATOM records:

>d6rh8b1 a.30.2.0 (B:243-320) automated matches {Thermotoga maritima [TaxId: 2336]}
rlkridrmktefianisaelrtpltaikayaetiynslgeldlstlkefleviidqsnhl
enllnelldfsrlerksl

Timeline for d6rh8b1:

• d6rh8b1 is new in SCOPe 2.07-stable
  
• d6rh8b1 appears in the current release, SCOPe 2.08