Lineage for d1qjgd_ (1qjg D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 31064Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 31100Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 31101Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 31102Species Comamonas testosteroni and Pseudomonas testosteroni [54436] (4 PDB entries)
  8. 31106Domain d1qjgd_: 1qjg D: [38105]

Details for d1qjgd_

PDB Entry: 1qjg (more details), 2.3 Å

PDB Description: crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin

SCOP Domain Sequences for d1qjgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjgd_ d.17.4.3 (D:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni and Pseudomonas testosteroni}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOP Domain Coordinates for d1qjgd_:

Click to download the PDB-style file with coordinates for d1qjgd_.
(The format of our PDB-style files is described here.)

Timeline for d1qjgd_: