Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
Protein automated matches [190839] (4 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [227717] (7 PDB entries) |
Domain d6rgyb2: 6rgy B:321-479 [381033] Other proteins in same PDB: d6rgya1, d6rgyb1, d6rgyc_, d6rgyd_ automated match to d2c2aa2 complexed with adp, cit, mg, so4 |
PDB Entry: 6rgy (more details), 2.2 Å
SCOPe Domain Sequences for d6rgyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rgyb2 d.122.1.3 (B:321-479) automated matches {Thermotoga maritima [TaxId: 243274]} qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp gtglglaitkeivelhggriwvesevgkgsrffvwipkd
Timeline for d6rgyb2:
View in 3D Domains from other chains: (mouse over for more information) d6rgya1, d6rgya2, d6rgyc_, d6rgyd_ |