SCOPe 2.07: Domain d6qzmc1: 6qzm C:1-85

Lineage for d6qzmc1 (6qzm C:1-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries)

8. Domain d6qzmc1: 6qzm C:1-85 [381015]
   Other proteins in same PDB: d6qzma2, d6qzmc2
   automated match to d3dc5a1
   complexed with mn, so4; mutant

Details for d6qzmc1

PDB Entry: 6qzm, 1.6 Å

PDB Description: h30 mnsod-3 mutant i

PDB Compounds: (C:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d6qzmc1:

Sequence; same for both SEQRES and ATOM records:

>d6qzmc1 a.2.11.0 (C:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
khtlpdlpfdyadlepvisheimqlhhqkfhatyvnnlnqieeklheavskgnlkeaial
qpalkfnggghinhsifwtnlakdg

Timeline for d6qzmc1:

• d6qzmc1 is new in SCOPe 2.07-stable
  
• d6qzmc1 appears in the current release, SCOPe 2.08