Lineage for d1a2ka_ (1a2k A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197184Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1197206Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)
  7. 1197221Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (10 PDB entries)
    Uniprot P61972
  8. 1197242Domain d1a2ka_: 1a2k A: [38100]
    Other proteins in same PDB: d1a2kc_, d1a2kd_, d1a2ke_
    complexed with gdp, mg, so4

Details for d1a2ka_

PDB Entry: 1a2k (more details), 2.5 Å

PDB Description: gdpran-ntf2 complex
PDB Compounds: (A:) nuclear transport factor 2

SCOPe Domain Sequences for d1a2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ka_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
hnfg

SCOPe Domain Coordinates for d1a2ka_:

Click to download the PDB-style file with coordinates for d1a2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1a2ka_: