Lineage for d1qmad_ (1qma D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599942Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 599966Family d.17.4.2: NTF2-like [54431] (5 proteins)
  6. 599988Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 600001Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (10 PDB entries)
  8. 600019Domain d1qmad_: 1qma D: [38099]

Details for d1qmad_

PDB Entry: 1qma (more details), 2.5 Å

PDB Description: nuclear transport factor 2 (ntf2) w7a mutant

SCOP Domain Sequences for d1qmad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmad_ d.17.4.2 (D:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiaeqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
hnfg

SCOP Domain Coordinates for d1qmad_:

Click to download the PDB-style file with coordinates for d1qmad_.
(The format of our PDB-style files is described here.)

Timeline for d1qmad_: