Lineage for d6rh2b1 (6rh2 B:246-320)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322230Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2322270Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2322288Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 2322289Protein automated matches [227713] (2 species)
    not a true protein
  7. 2322290Species Thermotoga maritima [TaxId:2336] [231990] (7 PDB entries)
  8. 2322294Domain d6rh2b1: 6rh2 B:246-320 [380981]
    Other proteins in same PDB: d6rh2a2, d6rh2b2, d6rh2c_, d6rh2d_
    automated match to d2c2aa1
    complexed with adp, so4

Details for d6rh2b1

PDB Entry: 6rh2 (more details), 2 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 5.3
PDB Compounds: (B:) sensor histidine kinase

SCOPe Domain Sequences for d6rh2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rh2b1 a.30.2.0 (B:246-320) automated matches {Thermotoga maritima [TaxId: 2336]}
ridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlenl
lnelldfsrlerksl

SCOPe Domain Coordinates for d6rh2b1:

Click to download the PDB-style file with coordinates for d6rh2b1.
(The format of our PDB-style files is described here.)

Timeline for d6rh2b1: